PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0033ss00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 219aa    MW: 24693.1 Da    PI: 10.8486
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0033ss00030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.7e-1396140347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ +++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
  Vang0033ss00030.1  96 PWTEEEHRQFLLGLQNVGKGDWRGISRNFVKTRTPTQVASHAQKY 140
                        7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.43988145IPR017930Myb domain
SuperFamilySSF466899.72E-1790144IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-1792143IPR006447Myb domain, plants
SMARTSM007172.5E-893143IPR001005SANT/Myb domain
PfamPF002493.1E-1096140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-1196140IPR009057Homeodomain-like
CDDcd001678.88E-996141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
LSHLTPFITK QNTNSPSSSC MNQTKSKMCT AEKDGIMLFG VRLTLPDNNP TVFRKSASMN  60
NLSPNSESPP PHHPNAGYAS EDVVHLCRRT RKRGIPWTEE EHRQFLLGLQ NVGKGDWRGI  120
SRNFVKTRTP TQVASHAQKY FLRRHTHNRR RRRSSLFDIT TDSVKEEERA VPSARSKPVL  180
PALPSLKMAE LDLNGRSLSL KLRLPESEEP SPVTFELV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-155AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508244.11e-128PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B03e-38MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0S3R1V71e-146A0A0S3R1V7_PHAAN; Uncharacterized protein
STRINGGLYMA08G40460.12e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.26e-44MYB_related family protein